SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004463 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004463
Domain Number 1 Region: 276-396
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000162
Family C1 set domains (antibody constant domain-like) 0.0043
Further Details:      
 
Domain Number 2 Region: 191-300
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000568
Family V set domains (antibody variable domain-like) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004463   Gene: ENSNLEG00000003709   Transcript: ENSNLET00000004698
Sequence length 468
Comment pep:known_by_projection supercontig:Nleu1.0:GL397358.1:6409983:6420703:1 gene:ENSNLEG00000003709 transcript:ENSNLET00000004698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQEGWCLLLCLALSGAEKPEPHPAERQWRAVDVVLDCFLAKDSGHHGALASSEDRARA
SLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEV
TCEISHYLLQMRETTVETAAWFMANVQVSGGGPSISMVMKTPRDAKNEVLWHPTLNLPLS
PQGTVRTAVEFQVMTQTQSLSFLLGSSASLDCGFSMAPGLDLISVEWRLQHKGRGQLVYS
WTAGQGQAVRKGATLEPEQLGMARDASLTLPSLTIQDEGTYICQITTSVYRAQQIIQLNI
QASPKVRLNLANEALLPTLICDIVGYYPLDVVVTWTREELSGSPAQVSGASFSSLRQSVA
GTYSISSSLVAEPGSAGATYTCQVTHISLEEPLRASTQVVPPERRTALGVIFASSLFLLA
LLFLRLQKRQAPTRVGLLQAERRETTSCADTQNSHLHEDRTARVSQPS
Download sequence
Identical sequences ENSNLEP00000004463 ENSNLEP00000004463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]