SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004507 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004507
Domain Number 1 Region: 37-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000628
Family V set domains (antibody variable domain-like) 0.0084
Further Details:      
 
Domain Number 2 Region: 140-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000117
Family C1 set domains (antibody constant domain-like) 0.016
Further Details:      
 
Domain Number 3 Region: 231-334
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000197
Family V set domains (antibody variable domain-like) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004507   Gene: ENSNLEG00000003742   Transcript: ENSNLET00000004744
Sequence length 377
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:14812699:14834186:1 gene:ENSNLEG00000003742 transcript:ENSNLET00000004744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAQTVLSFFLILITSLSGSQGIFPLAFFTYVPMNEQIIIGRLDEDIILPSSFERGSEVV
IHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYT
CYVGTAIQVITNKVVLKVGVFLTPMMKYEKRNTNSFLICSVLSVYPRPIIMWKMDNTPIS
ENNMEETGSLDPFSINSTLNITGSNSSYECTIENSLLKQTWTGHWTMKDGLHKMQSEHIS
LSCQPVNDYFSPNQDFKVTWSRMKSGTFSILAYYLSSSQNIIINESRFSWNKELINQSDF
SMNLMDLNLSDSGEYLCNISTDEYTLLTIHTVHVEPSQETASHNKGLWILVPSVILAAFL
LIWTIKCCRERRGVPPY
Download sequence
Identical sequences XP_012356517.1.23891 ENSNLEP00000004507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]