SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004510 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004510
Domain Number 1 Region: 468-755
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-67
Family Protein kinases, catalytic subunit 0.00000378
Further Details:      
 
Domain Number 2 Region: 183-371
Classification Level Classification E-value
Superfamily Fibronectin type III 5.54e-29
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 3 Region: 10-96
Classification Level Classification E-value
Superfamily Immunoglobulin 5.34e-16
Family V set domains (antibody variable domain-like) 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004510   Gene: ENSNLEG00000003740   Transcript: ENSNLET00000004747
Sequence length 849
Comment pep:known_by_projection supercontig:Nleu1.0:GL397306.1:2491491:2511914:1 gene:ENSNLEG00000003740 transcript:ENSNLET00000004747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGLKLMGAPVKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIG
FLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEAGLPHCSVGPGSLLPQSPLLLQEE
LSKSAMPKGAAWKTGTTKIGGPAPSPSVLNVTGVTQSTMFSCEAHNIKGLASSRTATSPS
TALPAAPFNITVTKLSSSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPF
TCLLRDLVPATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIHTDSGLILE
WEEVIPETSLEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVG
CGPWSQPLVVSSHDHAGQQGLPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFG
QAFDSVMAQGEPAVHFRAARSNRERPERIEAHILDSLGISDELKEKLEDVLIPEQQFTLG
RMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVA
KLVDGKIARRHFGRLSIATAHLYLKKKKKIHTHTRIQKLARCGGNLPLQTLIRFMVDIAC
GMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLAL
ESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDV
YDLMYQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLEL
PGGDQPYSGAGDGSGMGAVGGTPSDYRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQ
QGLLPHSSC
Download sequence
Identical sequences ENSNLEP00000004510 ENSNLEP00000004510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]