SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004512 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004512
Domain Number 1 Region: 533-821
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-85
Family Protein kinases, catalytic subunit 0.000000137
Further Details:      
 
Domain Number 2 Region: 66-166
Classification Level Classification E-value
Superfamily L domain-like 7.65e-16
Family Ngr ectodomain-like 0.00042
Further Details:      
 
Domain Number 3 Region: 203-290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000199
Family I set domains 0.039
Further Details:      
 
Domain Number 4 Region: 283-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000303
Family I set domains 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004512   Gene: ENSNLEG00000003678   Transcript: ENSNLET00000004749
Sequence length 838
Comment pep:known_by_projection supercontig:Nleu1.0:GL397309.1:16212981:16587732:1 gene:ENSNLEG00000003678 transcript:ENSNLET00000004749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWIRWHGPAMARLWGFCWLAVGFWRAAFACPTSCKCSASRIWCIDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQG
VGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQL
KPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKD
FHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNP
PTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYST
DYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIE
CITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Download sequence
Identical sequences G1QU92
ENSNLEP00000004512 ENSNLEP00000004512 XP_003267526.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]