SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004524 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004524
Domain Number 1 Region: 10-180,282-387
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.27e-48
Family FAD-linked reductases, N-terminal domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004524   Gene: ENSNLEG00000003718   Transcript: ENSNLET00000004761
Sequence length 486
Comment pep:known_by_projection supercontig:Nleu1.0:GL397308.1:11071569:11130407:1 gene:ENSNLEG00000003718 transcript:ENSNLET00000004761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVANFTRGRSINLALSH
RGRQALKAVDLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKRLVQDFFLLPAQPMISVKCSSFHFKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNDLSLCLPAFSRLRVPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLMHYMSPRPFLCLRRPWNWIAHFRNTTCFPAKAMDSLEQI
SSLISR
Download sequence
Identical sequences A0A2I3FZG4
ENSNLEP00000004524 ENSNLEP00000004524 XP_003267365.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]