SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004539 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004539
Domain Number 1 Region: 4-137,195-450,562-617
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.81e-76
Family GDI-like N domain 0.0000000000294
Further Details:      
 
Domain Number 2 Region: 451-561
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.08e-39
Family GDI-like 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004539   Gene: ENSNLEG00000003770   Transcript: ENSNLET00000004776
Sequence length 656
Comment pep:known_by_projection supercontig:Nleu1.0:GL397308.1:11177160:11179634:-1 gene:ENSNLEG00000003770 transcript:ENSNLET00000004776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADNLPTEFDVVIIGTGLPESILAAACSRSGQRVLHIDSRSYYGGNWASFSFSGLLSWLK
EYQQNNDIGEESTVAWQDLIHETEEAITLHKKDETIQHTEAFCYASQDMEDNIEEIGALQ
KNPSSGVSNTFTEVLDSALPEESQSSYFNSDEMPAKHTRKSDTEISLEVTDVEESVEKEK
YCGDKTCMHTVSDKDGDKDESKSTVEDNANEPVRNRITYSQIVKEGRRFNIDLVSKLLYS
QGLLIDLLIKSDVSRYVEFKNVTRILAFREGKVEQVPCSRADVFNSKELTMVEKRMLMKF
LTFCLDYEQHPDEYQAFRQCSFSEYLKTKKLTPNLQHFVLHSIAMTSESSCTTIDGLNAT
KNFLQCLGRFGNTPFLFPLYGQGEIPQGFCRMCAVFGGIYCLRHKVQCFVVDKESGRCKA
IIDHFGQRINAKYFIVEDSYLSEETCSNVQYKQISRAVLITDQSILKTDSDQQTSILIVP
PAEPGACAVRVTELCSSTMTCMKDTYLVHLTCSSSKTAREDLESVVKKLFTPYTETEINK
EELTKPRLLWALYFNMRDSSEISRSSYNGLPSNVYVCSGPDCGLGNEHAVKQAETLFQEI
FPAEEFCPPPPNPEDIIFDGDDKQPEASGTNNVIMAKLESSEESKNIESPEKHLQN
Download sequence
Identical sequences ENSNLEP00000004539 XP_003267366.1.23891 ENSNLEP00000004539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]