SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004556 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004556
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily RING/U-box 9.94e-18
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 2 Region: 87-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000029
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004556   Gene: ENSNLEG00000003779   Transcript: ENSNLET00000004793
Sequence length 407
Comment pep:known_by_projection supercontig:Nleu1.0:GL397327.1:10708533:10724332:1 gene:ENSNLEG00000003779 transcript:ENSNLET00000004793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKE
TSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQPLNIFCLTDMQLICGICATR
GEHTKHVFCSIEDAYAQERDAFESLFQSFETWRRGDALSRLDTLETSKRKSLQLLTKDSD
KVKEFFEKLQYTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFK
DVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP
QDTGTFISKIPWSFYKLFLLVLLLGLVIVFGPTMFLEWSLFDDLVTWKDCLSNISSYLTK
SADFIEQSVFYWEQVTDGFFIFNERFKNFTLVVLNNVAEFVCKYKLL
Download sequence
Identical sequences XP_003270149.1.23891 XP_003270150.1.23891 XP_004088181.1.23891 XP_012362413.1.23891 XP_012362415.1.23891 ENSNLEP00000004556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]