SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004593 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004593
Domain Number 1 Region: 921-1020
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000272
Family Fibronectin type III 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004593
Domain Number - Region: 374-423
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0144
Family Tubulin chaperone cofactor A 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004593   Gene: ENSNLEG00000003788   Transcript: ENSNLET00000004831
Sequence length 1031
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:5738554:5814489:1 gene:ENSNLEG00000003788 transcript:ENSNLET00000004831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXGAPASTDPASDDLASGDLSASELASDDLATGELASDELTSESTFDRTFEPNSVPVCEP
VPEIDNIEPSSNKDDDFLEKNGAGEKLEQIQSKDSLDEKNKADNNTDANEETLETDDNTI
CSDRPPENEKKVEEDIITELALGEDAISSSMEIDQGEKNEDETSADLVETINENVIEDDK
SENILENTDSMETDEIIPILEKLAPSEDELTCFSKTSLLPIDETNPDLEEKMESSFGSPS
KQESSESLPKEAFLVLSDEEDISGEKDESEVISQNETCSPAEVESNEKDNKPEEEEQVIH
EEDERPSEKNEFSRRKRSKSEDMDNVQSKRRRYMEEEYEAEFQVKITAKGDINQKLQKVI
QWLLEEKLCALQCAVFDKTLAELKTRVEKIECNKRHKTVLTELQAKIARLTKRFEAAKED
LKKRHEHPPNPPVSPGKTVNDVNSNNNMSYRNAGTVRQMLESKRNVSESAPPSFQTPVNT
VSSTNLVTPPAVVSNQPKLQTPVTSGSLTATPVLPAPNTATVVATTQVPSGNPQPTISLQ
PLPVILHVPVAVSSQPQLLQSHPGTLVTNQPSGNVEFISVQSPPTVSGLTKNPVSLPSLP
NPTKPSNVPSVPSPSIQRNPTASAAPLGTTLAVQAVPTAHSIVQATRTSLPTVGPSGLYS
PSTNRGPIQMKIPISAFSTSSPAEQSSNTTPRIENQTNKTIDASVSKKAADSTSQSGKAT
GSDSSGVIDLTMDDEESGASQDPKKLNHTPVSTMNSSQPVSRPLQPIQPAPPLQPSGVPT
SGPSQTTIHLLPTAPTTVNVTHRPVTQVTTRLPVPRAPANHQVVYTTLPAPPAQAPLRGT
VMQAPAVRQVNPQNSVTVRVPQTTTYVVNNGLTLGSTGPQLTVHHRPPQVHTEPPRPVHP
APLPEAPQPQRLPPEAASTSLPQKPHLKLARVQSQNGIVLSWSVLEVDRSCATVDSYHLY
AYHEEPSATVPSQWKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRFGPFCDPQ
STDVISSTQSS
Download sequence
Identical sequences ENSNLEP00000004593 ENSNLEP00000004593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]