SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004622 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004622
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily Fibronectin type III 5.36e-18
Family Fibronectin type III 0.0000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004622   Gene: ENSNLEG00000003834   Transcript: ENSNLET00000004861
Sequence length 337
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:18760637:18771772:1 gene:ENSNLEG00000003834 transcript:ENSNLET00000004861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHKPEIKGNMSGNFTYILDKLIPNTNYCVSVYFEHGDEQPVIKSPLKCTLLPPGQESESA
ESAKIGGIITVFLIALVLTSTIVTLKWIGCICLRNSLPKVLNFHNFLAWPFPNLPPLEVM
DIVEVIYINRKKKVWDYNYDDESDSDTEAAPRTSGGGYTMHGLTVRPLGQASATSTESQF
IDPESEEEPDLPEVDVELPTTPKGRPQHLELLSGPCERRESPLQDPFPEEDYSSNEGSGG
RITFNVDLNSVFLRVLDDEDSDDLEEAPLMISSHPEEMVDPEDPDNVQSSHLLASGEGTQ
QTFPSPSSEGLWSEDAPSDQSDTSESDVDLGDGYIMR
Download sequence
Identical sequences ENSNLEP00000004622 ENSNLEP00000004622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]