SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004656 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004656
Domain Number 1 Region: 77-272
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.22e-59
Family CRAL/TRIO domain 0.00000000255
Further Details:      
 
Domain Number 2 Region: 276-396
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 2.88e-38
Family Supernatant protein factor (SPF), C-terminal domain 0.000000256
Further Details:      
 
Domain Number 3 Region: 2-73
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.28e-17
Family CRAL/TRIO N-terminal domain 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004656   Gene: ENSNLEG00000003775   Transcript: ENSNLET00000004895
Sequence length 403
Comment pep:novel supercontig:Nleu1.0:GL397272.1:2772229:2800154:1 gene:ENSNLEG00000003775 transcript:ENSNLET00000004895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSPKQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQESXXXXXXHV
EFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDL
LRTKMRECELLLQECARQTTKLGKKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEE
NYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVE
YGGTMTDPDGNPKCKSKINYGGDIPKKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPG
CVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGI
YVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK
Download sequence
Identical sequences ENSNLEP00000004656 ENSNLEP00000004656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]