SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004671 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004671
Domain Number 1 Region: 92-273
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.7e-50
Family CRAL/TRIO domain 0.00000000854
Further Details:      
 
Domain Number 2 Region: 12-89
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.71e-19
Family CRAL/TRIO N-terminal domain 0.00000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004671   Gene: ENSNLEG00000003861   Transcript: ENSNLET00000004911
Sequence length 278
Comment pep:known_by_projection supercontig:Nleu1.0:GL397315.1:13623118:13646790:-1 gene:ENSNLEG00000003861 transcript:ENSNLET00000004911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEARSQPSAGPQLNALPDHSPLLQPGLAALRRRAREAGVPLAPLPLTDSFLLRFLRARD
FDLDLAWRLLKNYYKWRAECPEISADLHPRSIIGLLKAGYHGVLRSRDPTGSKVLIYRIA
YWDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAIFDLEGWQFSHAFQITPSVAKKIA
AVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDI
LPLEYGGEEFSMEEICQEWTNFIMKSEDYLSSISESIQ
Download sequence
Identical sequences G1QUQ1
XP_003268397.1.23891 ENSNLEP00000004671 ENSNLEP00000004671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]