SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004688 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004688
Domain Number 1 Region: 160-268
Classification Level Classification E-value
Superfamily Cadherin-like 8.9e-26
Family Cadherin 0.00029
Further Details:      
 
Domain Number 2 Region: 269-384
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-24
Family Cadherin 0.00081
Further Details:      
 
Domain Number 3 Region: 381-497
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-21
Family Cadherin 0.017
Further Details:      
 
Domain Number 4 Region: 489-597
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-20
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 78-167
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000003
Family Cadherin 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004688   Gene: ENSNLEG00000003851   Transcript: ENSNLET00000004928
Sequence length 799
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:14003760:14411493:-1 gene:ENSNLEG00000003851 transcript:ENSNLET00000004928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPERLAEMLLDLWTPLIILWITLPPCIYMAPMNQSQVLMSGSPLELNSLGEEQRILNRSK
RGWVWNQMFVLEEFSGPEPILVGRLHTDLDPGSKKIKYILSGDGAGTIFQINDVTGDIHA
IKRLDREEKAEYTLTAQAVDWETSKPLEPPSEFIIKVQDINDNAPEFLNGPYHATVPEMS
ILGTSVTNVTATDADDPVYGNSAKLVYSILEGQPYFSIEPETAIIKTALPNMDREAKEEY
LVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPEDVVLGTAIGRVKA
NDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGIIRLRKPLDFETKKSYTLKVEAANV
HIDPRFSGRGPFKDTATVKIVVEDADEPPVFSSPTYLLEVHENAALNSVIGQVTARDPDI
TSSPIRFSIDRHTDLERQFNINADDGKITLATPLDRELSVWHNITIIATEIRNHSQISRV
PVAIKVLDVNDNAPEFASEYEAFLCENGKPGQVIQTVSAMDKDEPKNGHYFLYSLLPEMV
NNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIVISDSGNPPLSSTSTLTIRVCGCS
NDGVVQSCNVEAYVLPIGLSMGALIAILACIILLLVIVVLFVTLRRHKNEPLIIKDDEDV
RENIIRYDDEGGGEEDTEAFDIATLQNPDGINGFLPRKDIKPDLQFMPRQGLAPVPNGVD
VDEFINVRLHEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESTTSDSDQNFDYLSDWG
PRFKRLGELYSVGESDKET
Download sequence
Identical sequences G1QUR8
XP_003263177.1.23891 ENSNLEP00000004688 ENSNLEP00000004688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]