SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004692 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004692
Domain Number 1 Region: 111-225
Classification Level Classification E-value
Superfamily Fibronectin type III 4.13e-22
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 2 Region: 18-132
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000127
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004692   Gene: ENSNLEG00000003878   Transcript: ENSNLET00000004932
Sequence length 315
Comment pep:known_by_projection supercontig:Nleu1.0:GL397293.1:18924570:18955046:1 gene:ENSNLEG00000003878 transcript:ENSNLET00000004932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFQIKEKKKRPDPLSQLPTPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYRVQFKYTDS
KWFMADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWF
QHYRNETVGPPKNIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGRTQQVKGPF
RSNSISLDNLKPFRVYCLQVQAQLLWNKSNIFRVGHLSNTSCYETMADASTELQQVILIS
VGTFSLLLVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSP
KDDVWDSVSHYLVSR
Download sequence
Identical sequences ENSNLEP00000004692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]