SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004738 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004738
Domain Number 1 Region: 152-260
Classification Level Classification E-value
Superfamily Cadherin-like 2.05e-26
Family Cadherin 0.00021
Further Details:      
 
Domain Number 2 Region: 378-481
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-23
Family Cadherin 0.0033
Further Details:      
 
Domain Number 3 Region: 262-376
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-23
Family Cadherin 0.00077
Further Details:      
 
Domain Number 4 Region: 67-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000209
Family Cadherin 0.0048
Further Details:      
 
Domain Number 5 Region: 482-593
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000214
Family Cadherin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004738   Gene: ENSNLEG00000003882   Transcript: ENSNLET00000004983
Sequence length 796
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:17472346:17651395:-1 gene:ENSNLEG00000003882 transcript:ENSNLET00000004983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKENYCLQAALVCLGMLCHSQAFAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQF
FVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREE
RAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQ
VTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKD
MGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIGEN
GLVTYNIVDGDGMESFEITTDYETQEGVIKLKKPVDFETKRAYSLKVEAANVHIDPKFIS
NGPFKDTVTVKIAVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIRYS
IDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVPVAIRVLD
VNDNPPKFAAPYEGFICESDQTKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHNPN
FTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGA
LLSCNAEAYILNAGLSTGALIAILACIVILLVIVVLFVTLRRQKKEPLIVFEEEDVRENI
ITYDDEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEYQYMPRPGLRPAPNSVDVDDF
INTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYDYLQNWGPRFK
KLADLYGSKDTFDDNS
Download sequence
Identical sequences A0A2I3H3C5
ENSNLEP00000004738 XP_003263178.1.23891 XP_012360498.1.23891 ENSNLEP00000004738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]