SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004749 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004749
Domain Number 1 Region: 249-364
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 471-574
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-21
Family Cadherin 0.0021
Further Details:      
 
Domain Number 3 Region: 365-477
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-19
Family Cadherin 0.0039
Further Details:      
 
Domain Number 4 Region: 153-256
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-17
Family Cadherin 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004749   Gene: ENSNLEG00000003928   Transcript: ENSNLET00000004994
Sequence length 782
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:18958708:18979738:1 gene:ENSNLEG00000003928 transcript:ENSNLET00000004994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRLMMLLTTSGACLGLLAVATVAVAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEK
NTSLPHHVGKVRLKPQDRRSHQQLAHSDSGGVMAMVAKVVIDIVVVVGVEMIRVKVVAIV
VERGILQNTDSYSSKLSRSSETNETQPDPHLLFTSQQPQGSLSAGTSVISVTAVDADDPT
VGDHASVMYQILKGKEYFAIDNSGRIVTITKSLDREKQARYEIVVEARDAQGLRGDSGTA
TVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRGDY
QDAFTIETNPTHNEGIIKPAKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVIIN
ITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFRVT
KKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFAQP
YQPKVCENAAHGQLVLQISAIDKDITPRNVKFKFTLNTENNFTLTDNHDNTANITVKYGQ
FDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQAVV
AILLCILTITVITLLIFLRRRLRKQAHAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDVSV
LNSVRHGGAKPLRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDGDG
PPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPREEL
LY
Download sequence
Identical sequences ENSNLEP00000004749 ENSNLEP00000004749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]