SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004806 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004806
Domain Number 1 Region: 624-671
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000901
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 2 Region: 713-753
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000139
Family Ovomucoid domain III-like 0.024
Further Details:      
 
Domain Number 3 Region: 757-788
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000402
Family Ovomucoid domain III-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004806   Gene: ENSNLEG00000003935   Transcript: ENSNLET00000005054
Sequence length 971
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:21830253:21918213:-1 gene:ENSNLEG00000003935 transcript:ENSNLET00000005054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVRASLRGALLLLLAVAGVAEVAGGLAPGSAGALCCNHSKDNQMCRDVCEQIFSSKSE
SRLKHLLQRAPDYCPETMVEIWSCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQA
SSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQI
KAVENYCASVSPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNACKRILMSKKTEM
EIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPPPSTGLDGAKLHCCSKANTST
CRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGCRNLTYCTNFN
NRPTELFRSCNAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIACSLQIK
PCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRP
STLGNIVEEVTHPCNPNPCPANELCEVNRKGCPSGDPCLPYFCVQGCKLGEASDFIVRQG
TLIQVPSSAGEVGCYKICSCGQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFSIDCNV
CSCFAGNLVCSTRLCLSEHSSEDDRRTFTGLPCNCADQFVPVCGQNGRTYPSACIARCVG
LQDHQFEFGSCMSKDPCNPNPCQKNQRCIPKPQVCLTTFDKFGCSQYECVPRQLACDQVQ
DPVCDTDHMEHNNLCTLYQRGKSLSYKGPCQPFCRATEPVCGHNGETYSSVCAAYSDRVA
VDYYGDCQAVGVLSEHSSVAECASVKCPSLLAAGCKPIIPPGACCPLCAGMLRVLFDKEK
LDTIAKVTNKKPITVLEILQKIRMHVSVPQCDVFGYFSIESEIVILIIPVDHYPKALQIE
ACNKEAEKIESLINSDSPTLASHVPLSALIISQVQVSSSVPSAGIRARPSCHSFLLPLSL
GLALHLLWTYN
Download sequence
Identical sequences G1QV36
ENSNLEP00000004806 XP_003263394.1.23891 ENSNLEP00000004806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]