SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004819 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004819
Domain Number 1 Region: 464-649
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.06e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 329-420
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000327
Family WWE domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004819
Domain Number - Region: 238-262
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00973
Family CCCH zinc finger 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004819   Gene: ENSNLEG00000003977   Transcript: ENSNLET00000005069
Sequence length 657
Comment pep:known_by_projection supercontig:Nleu1.0:GL397268.1:10440957:10473312:1 gene:ENSNLEG00000003977 transcript:ENSNLET00000005069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPIL
NTLLESGSLDGVFRSRNQSTEENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQ
IAEAHPSTEAPEQVVPIQDHSFPSETFSGTVADSTTGHFQTDLLHPVSSDVPTSPDCLDK
VIDYVPGIFQENSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGI
EICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQSVFNDSQEHLERFYCNPENDR
MRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSIYHTVWKFFCRDHFGWREY
PESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFILLPYLQTLGG
VPTQAPPPLEATSSSQIICPDGVTSANFYPETWVYMHPSQDFIQVPVSAEDKSYRIIYNL
FHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVD
GICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGS
HGMRRPPPVNPGSVTSDLYDSCVDNFFEPQIFVIFNDDQSYPYFVIQYEEVSNTVSI
Download sequence
Identical sequences G1QV49
XP_003256387.1.23891 XP_012366264.1.23891 XP_012366265.1.23891 ENSNLEP00000004819 ENSNLEP00000004819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]