SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004848 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004848
Domain Number 1 Region: 70-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000474
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004848   Gene: ENSNLEG00000004007   Transcript: ENSNLET00000005099
Sequence length 244
Comment pep:novel supercontig:Nleu1.0:GL397313.1:6816443:6845710:-1 gene:ENSNLEG00000004007 transcript:ENSNLET00000005099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSNPRTPCTFERFRIPGLTGCILSFQLKVCFLPVMWLFILLSLALISDAMVMDEKVKE
SFVLDTASAICNYNARYKDHPKYWCRGYFRDYCNIIAFSRNSTNHVALRDTGNQLIVTMS
CLTKEDTGWYWCGIQRDFARDDMDFTELIVTDNEGTLANHFWSGKDLSGNKTRRCKAPEV
VRKADRSRTSILIICILITGLGIISVISHLTKRRRSQRNRRVGNSLKHFSRVLTPKEMAP
TEQM
Download sequence
Identical sequences ENSNLEP00000004848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]