SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004859 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000004859
Domain Number - Region: 184-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00529
Family EGF-type module 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004859   Gene: ENSNLEG00000003987   Transcript: ENSNLET00000005110
Sequence length 472
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:22092689:22118383:-1 gene:ENSNLEG00000003987 transcript:ENSNLET00000005110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPS
VALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAV
TCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMR
TFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLC
LSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFL
GSLMSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATA
WTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS
VGFLLPPRAKTDHRVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS
Download sequence
Identical sequences A0A2K5TXX2 A0A2K6BH00 A0A2K6L2P4 F7HKY6 G1QV89 H2PRR6
ENSNLEP00000004859 XP_005581399.1.63531 XP_007966988.1.81039 ENSPPYP00000021377 9600.ENSPPYP00000021377 ENSPPYP00000021377 ENSNLEP00000004859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]