SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004909 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004909
Domain Number 1 Region: 63-169
Classification Level Classification E-value
Superfamily Immunoglobulin 6.3e-16
Family V set domains (antibody variable domain-like) 0.046
Further Details:      
 
Domain Number 2 Region: 264-361
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000204
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 165-261
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000903
Family C1 set domains (antibody constant domain-like) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004909   Gene: ENSNLEG00000004049   Transcript: ENSNLET00000005162
Sequence length 548
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:17454125:17516236:1 gene:ENSNLEG00000004049 transcript:ENSNLET00000005162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTPRPSPLCPGGGKAQLSSASLLGAGILLQPPTPPLLLLLFPLLLFSRLCGALAGPII
VEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRV
LFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSL
IDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSFPNETATIVSQYKLFPTRFARG
RRITCVVKHPALEKDIRYSFLLDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPFK
SVWSRLDGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQKVIYISDPPTT
TTLQPTIQWHPSTADIEDLATEPKKLPFPLSTLATIKDDTIATIIASVVGGALFIVLVSV
LAGIFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLQQDELDSYPDSVKKENKNPVNNL
IRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGSV
ISRREWYV
Download sequence
Identical sequences A0A2I3HKQ3
ENSNLEP00000004909 XP_003261837.1.23891 ENSNLEP00000004909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]