SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004927 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004927
Domain Number 1 Region: 38-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000242
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004927
Domain Number - Region: 158-283
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000117
Family V set domains (antibody variable domain-like) 0.087
Further Details:      
 
Domain Number - Region: 296-353
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000256
Family C1 set domains (antibody constant domain-like) 0.016
Further Details:      
 
Domain Number - Region: 489-557
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 0.0419
Family Bcl-2 inhibitors of programmed cell death 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004927   Gene: ENSNLEG00000004063   Transcript: ENSNLET00000005181
Sequence length 595
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:17915880:18032974:1 gene:ENSNLEG00000004063 transcript:ENSNLET00000005181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVQSVQKTMEKKWKYCAVYYIIQIHFVKGVWEKTVNTEENIYATLGSDVNLTCQTQTTG
FLVQMQWSKVTDKVDLIALYHPQYGFYCAYGSPCESLVTFTETPENGSKWTLHLRNMSSS
VSGRYECMLTLYPEGIQTKIYNLLIQTHVTPDEWKSNHTIEIEINQTLEIPCFQNSSSEI
SSEFTYAWSVENSSTDFWVLLSKGIKDDNGTQETLISQNHLISNSTLLKDRVKLGTDYRL
HLSPVQIFDDGRKFSCHVRVGPDKILRSSTTVKVFAKPEIPVIMENNSTEVLVERRFTCL
LKNVFPKANITWFIDGSFLHDEKEGIYITNEEREGKDGFLELKSVLTRVHSNKPAQSDNL
TIWCMALSPVPGNKVWNSSSEKITFLLGSEISTTDPPLSVTESTLDTQPSPASSVSPTRY
SATSSVTLVDGSALRPNTTPQPSNSSMTTRGFDYPWTSSGTDTKKSVSRIPSETHSSSSS
SGAGSTLHDNVFTSTARAFSEVPTTANGSMKTNHVHITGIVVKKPKDGMSWPVIVAALLF
CCMILFGLGVRKWCQYQKEIMERPPPFKPPPPPIKYTCIQEPNESDLPYHEMETL
Download sequence
Identical sequences ENSNLEP00000004927 XP_003261839.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]