SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004986 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004986
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000343
Family Fibronectin type III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004986   Gene: ENSNLEG00000004128   Transcript: ENSNLET00000005244
Sequence length 224
Comment pep:known_by_projection supercontig:Nleu1.0:GL397318.1:1580856:1583822:-1 gene:ENSNLEG00000004128 transcript:ENSNLET00000005244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIEVGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHHEEKVPRTISS
VVLEHLAPSTLYFLCISCKKAAFPYRHYCTMFHTLDKTPLAPGSSLVDPQISLWVLMAIL
LACFTAVLAFICLQFWCVRCHEPRWSYRAGHMEEANGLVRWPEEAPDLGQREEDLQGLPL
VEVPRKNSRDGAELDPEANQDAPDAGALRRGGGDQPAILPHCGE
Download sequence
Identical sequences G1QVL5
XP_003268627.1.23891 ENSNLEP00000004986 ENSNLEP00000004986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]