SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000004990 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000004990
Domain Number 1 Region: 174-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000296
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 2 Region: 213-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000242
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 134-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000016
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 97-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000004990
Domain Number - Region: 64-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0112
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000004990   Gene: ENSNLEG00000004116   Transcript: ENSNLET00000005248
Sequence length 383
Comment pep:known_by_projection supercontig:Nleu1.0:GL397304.1:16358377:16367155:1 gene:ENSNLEG00000004116 transcript:ENSNLET00000005248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERC
VRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCL
PGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLM
RPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCVCPS
GYGGKTCELVLPVPDPPTTVDTPLGPTSAVMVPATGPAPHSAGAGLLRISVKEVVRRQEA
GLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYAPACQDQECQV
SMLPAGLPLPPDLPPEPGKTTAL
Download sequence
Identical sequences A0A2I3HJM8
XP_003266283.1.23891 ENSNLEP00000004990 ENSNLEP00000004990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]