SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005028 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005028
Domain Number 1 Region: 324-452
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-18
Family Cadherin 0.0013
Further Details:      
 
Domain Number 2 Region: 120-233
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000542
Family Cadherin 0.00039
Further Details:      
 
Domain Number 3 Region: 442-555
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000114
Family Cadherin 0.0022
Further Details:      
 
Domain Number 4 Region: 18-118
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000002
Family Cadherin 0.0031
Further Details:      
 
Domain Number 5 Region: 561-659
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000186
Family Cadherin 0.0051
Further Details:      
 
Domain Number 6 Region: 264-336
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000428
Family Cadherin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005028   Gene: ENSNLEG00000004109   Transcript: ENSNLET00000005288
Sequence length 829
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:19499850:19510969:-1 gene:ENSNLEG00000004109 transcript:ENSNLET00000005288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAWLWLLCVSVAQALPEAQPAELSVDVPENYGGNFPLYLTKLPLPREGAEGQIVLSGD
SGKAAEGPFAVDPDSGFLLVTRALDREEQAEYQLQVTLETQDGRVLWGPQPVLVHVKDEN
DQVPHFSQAIYRARLSQGTRPGIPFLFLEASDRDEPGTANSDLRFHVLSQVPAQPSPDMF
QLETQLGALALSPKGSTSLDHALERTYHLLVQVKDMGDQASGHQATATVEVSIIESTWVP
LEPIHLAENLKVLYPHHMAQVHWSGGDVHYHLESHPLGPFDVNAEGNLYVTRQLDREAQA
EYLLQVRAQNSCGEDYAAPLELHVLVMDENDNVPVCPPRGPAVSIPELSPPGTEVTRLSA
EDADAPGSPNSHIVYQLLSPEPEDGVEGRAFQVDPTSGSVTLGVLPLRAGQNILLLVLAM
DLAGIEGGFSSTCEVEVTVTDINDHAPEFITSQIGPISLPEDVEPGTLVAMLTATDADLE
PAFRLMDFAIERGDTEGTFGLDWEPDSGHVRLRLCKNLSYEVAPSHEVVVVVRSVAKLVG
PGPGPGATATVTVLVERMMPPPKLDQESYEASVPISAPAGSLLLTIQPSDPISRTLRFSL
VNDSEGWLCIEKVSGEVHTAQSLQGAQPGDTYTVLVEAQDTDEPKLSTSVPLVIHFLKAP
PAPALTPAPVPSRYLCTPRQDHGLIVSGPSKDPDLASGHGPYNFTLGPNPTVQRDWRLQT
LNGSHAYLTLALHWVEPREHIIPVVVSHNAQMWQLLVRVIVCRCNMEGQCMRKVGRMKGM
PTKLSAVGILVGTLVAIGIFLILIFTHWTMSRKKDPDQPADSVPLKATV
Download sequence
Identical sequences ENSNLEP00000005028 XP_003262912.1.23891 ENSNLEP00000005028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]