SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005085 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005085
Domain Number 1 Region: 582-825
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.39e-80
Family Eukaryotic proteases 0.0000484
Further Details:      
 
Domain Number 2 Region: 87-216
Classification Level Classification E-value
Superfamily SEA domain 6.02e-19
Family SEA domain 0.0087
Further Details:      
 
Domain Number 3 Region: 232-345
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000379
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 4 Region: 351-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000012
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 5 Region: 469-514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 544-583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 503-539
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000038
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005085   Gene: ENSNLEG00000004193   Transcript: ENSNLET00000005345
Sequence length 829
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:18405141:18454609:1 gene:ENSNLEG00000004193 transcript:ENSNLET00000005345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKENSDVSAAPADLKISNISVQVVSAQKKLPGRRPPQRPIGKAKPKKQSKKKLPFWNVQ
NKIILFTVFLFILAVIAWTLLWLYISKTESKDAFYFAGMFRITNIEFLPAYRQKESREFL
SVARTVQQINLVYTTSAFSKFYEQSVVADVSSNNKGGLLVHFWIVFVMPRAKGHIFCEDC
VAAILKDSIQTSVINRTSVGSLQGLAVDMDSVVLNAGLRSDYSSTIGSADKGCSQYFYAE
HLSLHYPLEISATSGRLMCHFKLVAIVGYLIRLSIKSIQIEADNCVTDSLTIYDSLLPIR
SSILYRICEPTRTLMSFVSTNNLMLVTFKSPHIRRLSGIRAYFEVIPEQKCGNTVLVKDT
TGFEGKISSPYYPSYYPPKCKCTWKFQTSLSTLGIALKFYNYSITKKSMKGCEHGWWEIN
EHMYCGSYMDHQTIFRVPSPLVHIQLQCSSRLSDKPLLVEYGSYNISQPCPVGSFRCSSG
LCVPQAQRCDGVNDCFDESDELFCVSPQPACNTSSFRQHGPLICDGFRDCENGRDEQNCT
QSIPCNNRTFKCGNDICFRKQNAKCDGTVDCPDGSDEEGCTCSRSSSTLHRIIGGTDTLE
GGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFV
SPVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPAGQRVRSGEKCWVTG
WGQRHEADNKGSLVLQQAEVELIDQTLCVSTYGIITSRMLCAGIMSGKRDACKGDSGGPL
SCRRKSDGKWILTGIVSWGHGCGRPKFPGVYTRVSNFVPWIHKYVPFLL
Download sequence
Identical sequences ENSNLEP00000005085 ENSNLEP00000005085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]