SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005098 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005098
Domain Number 1 Region: 1899-2181
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000112
Further Details:      
 
Domain Number 2 Region: 18-136
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.07e-18
Family Cysteine rich domain 0.032
Further Details:      
 
Domain Number 3 Region: 326-419
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000001
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 4 Region: 1034-1114
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000136
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 5 Region: 858-939
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000199
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 6 Region: 1388-1468
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000227
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 7 Region: 504-583
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000502
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 8 Region: 946-1025
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000713
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 9 Region: 1123-1201
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000786
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 10 Region: 682-763
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000117
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 11 Region: 1572-1711,1769-1805
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000206
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number 12 Region: 1300-1380
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000249
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 13 Region: 592-673
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000353
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 14 Region: 1210-1301
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000365
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 15 Region: 419-494
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000722
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 16 Region: 769-859
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000755
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 17 Region: 1477-1566
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000149
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 18 Region: 252-317
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000313
Family Fibronectin type III 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005098   Gene: ENSNLEG00000004145   Transcript: ENSNLET00000005358
Sequence length 2215
Comment pep:known_by_projection supercontig:Nleu1.0:GL397276.1:6134803:6251613:-1 gene:ENSNLEG00000004145 transcript:ENSNLET00000005358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEFYVVILTCLIFRNSEGFQIVHVQKQQCLFKNEKVVVGSCNRTIQNQQWMWTEDEKL
LHVKSALCLAISNSSRGPSRSAILDRCSQAPRWTCYDQEGFLEVENASLFLQKQGSRVVV
KKARKYLHSWMKIDVNKEGKLVNESLCLKKAGLGAEISVRSTRNTAPPQIPTTFNAVPDS
LERLIRNTTEAFIRNAAENYIRSSSERQHPNLHMTGITDTSWVLSTTQPFSSTTEETGLA
EPERCNFTLAESKASSHSVSIQWRILGSPCNFSLIYSSDTLGAALCPPFRIDNTTYGCNL
QDLQAGTIYNFKIISLDEERTVVLQTDPLPPARFGVSKEKTTSTSLHVWWTPSSGKVTSY
EVQLFDENNQKIQGVQIQESTSWNEYTFFNLTAGSKYNITITAVSGGKHSSSVYTNGSTV
PSPVKDIGISTKANSLLISWSHGSGNVERYRLMLMDKGILVHGGVVDKHATSYAFHGLTP
GYLYNLTVVTEAAGLQNYRWKLVRTAPMEVSNLKVTNDGSLTSLKVKWQRPPGNVDSYNI
TLSHKGTIKESRVLAPRVTETHFKELAPGRLYQVTVSCVSGELSAQKMAVGRTFPDKVAN
LEANNNGRMRSLVVSWSPPAGDWEQYRILLFNDSVVLLNITVGKEETQYVLDDTGLVPGR
QYEVEVIVESGNLKNSERCQGRTVPLAVLQLRVKHANETSLSIMWQAPVAEWEKYIISLA
DRDLLLIHKSLSKDAKEFTFTDLVPGRKYMATVTSISGDLKNSSSVKGRTVPAQVTDLHV
ANQGMTSSLFTNWTQAQGDVEFYQVLLIHENVVIKNESISSETSRYSFHSLKSGSLYSVV
VTTVSGGISSRQVVVEGRTVPSSVSGVTMNNSGRNDYLSVSWLPAPGDVDNYEVTLSHDG
KVVQSLVIAKSVRECSFSSLTPGRLYTVTITTRSGKYENHSFSQERTVPDKVQGVSVSNS
ARSDYLRVSWVHATGDFDYYEVTIKNKNNFIQSKSIPKLENECVFVQLVPGRLYSVTVTT
KSGQYEASEQGNGRTIPEPVKDLTLRNRSTEDLHVTWSGANGDVDQYEIQLLFNDMKVFP
PFHLVNTATEYRFTSLTPGRQYKILVLTISGDVQQSAFIEGFTVPSAVKNIHISPNGATD
SLTVNWTPGGGDVDSYTVSAFRHSQKVDSQTIPKHVFEHTFHRLEAGEQYQITIASVSGS
LKNQINVVGRTVPASVQGVIADNAYSSHSLIVSWQKAAGVAERYDILLVTENGILLRNTS
EPATTKQHKFEDLTPGKKYKIQILTVSGGLFSKEAHTEGRTVPAAVTDLRITENSTRHLS
FRWTASEGELSWYNIFLYNPDGNLQERAQVDPQVQSFSFQNLLQGRMYKMVIVTHSGELS
NESFIFGRTVPASVSHLRGSNRNMTDSLWFSWSPASGDFDFYELILYNPNGTKKENWKDK
DLTEWRFHGLVPGRKYTLWVVTHSGDLSNKVTAEGRTAPSPPSLMSFADIANTSLAITWK
GPPDWTDYNDFELQWLPRDALTVFNPYNNRKSEGRIMYGLRPGRAYQFSVKTVSGDSWKT
YSKPIFGSVRTKPDKIQNLHCRPQNSTAIACSWIPPDSDFDGYSIECRKMDTQEVEFSRK
LEKEKSLLNIMMLVPHKRYLVSIKVQSASMTSEVVEDSTITMIDRPPPPPPHIRVNEKDV
LISKSSINFTVNCSWFSDTNGAVKYFTVVVREADGSDELKPEQQHPLPSYLEYRHNASIR
VYQTNYFASKCAENPNSNSKSFNIKLGAEMESLGGKCDPTQQKFCDGPLKPHTAYRISIR
AFTQLFDEDLKEFTKPLYSDTFFSLPITTESEPLFGAIEGVSAGLFLIGMLVAVVALLIC
RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGFIFNYSPIKINQFEGHFMKLQADSNYL
LSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASY
IPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDS
LYYGDLILQMLSESVLPEWTIREFKICSEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQ
FVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLH
RVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH
Download sequence
Identical sequences ENSNLEP00000005098 ENSNLEP00000005098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]