SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005162 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005162
Domain Number 1 Region: 546-611
Classification Level Classification E-value
Superfamily RING/U-box 6.86e-19
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005162   Gene: ENSNLEG00000004241   Transcript: ENSNLET00000005425
Sequence length 691
Comment pep:known_by_projection supercontig:Nleu1.0:GL397318.1:3515330:3565066:-1 gene:ENSNLEG00000004241 transcript:ENSNLET00000005425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRNHRIASSLCGDQVHTKKKKEKKKTNMAAKEKLEAVLNVALRVPSIMLLDVLYRWDVS
SFFQQIQRSSLSNNPLFQYKYLALNMHYVGYILSVVLLTLPRQHLVQLYLYFLTALLLYA
GHQISRDYVRSELEFAYEGPMYLEPLSMNRFTTALIGQLVVCTLCSCVMKTKQIWLFSAH
MLPLLARLCLVPLETIVIINKFAMIFTGLEVLYFLGSNLLVPYNLAKSAYRELVQVVEVY
GLLALGMSLWNQLVVPVLFMVFWLVLFALQIYSYFSTRDQPASRERLLFLFLTSIAECCS
TPYSLLGLVFTVSFVALGVLTLCKFYLQGYRAFMNDPAMNRGMTEGVTLLILAVQTGLIE
LQVVHRAFLLSIILFIVVASILQSMLEIADPIVLALGASRDKSLWKHFRAVSLCLFLLVF
PAYMAYMICQFFHMDFWLLIIISSSILTSLQVLGTLFIYVLFMVEEFRKEPVENMDDVIY
YVNGTYRLLEFLVALCVVAYGVSETIFGEWTVMGSMIIFIHSYYNVWLRAQLGWKSFLLR
RDAVNKIKSLPIATKEQLEKHNDICAICYQDMKSAVITPCSHFFHAGCLKKWLYVQETCP
LCHCHLKNSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNNER
ITRRPDNQEGAFDPKEYPHSAKDEAHAVESA
Download sequence
Identical sequences ENSNLEP00000005162 ENSNLEP00000005162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]