SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005171 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005171
Domain Number 1 Region: 627-1018
Classification Level Classification E-value
Superfamily RNI-like 3.01e-77
Family 28-residue LRR 0.0000173
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily DEATH domain 4.59e-24
Family Pyrin domain, PYD 0.0058
Further Details:      
 
Domain Number 3 Region: 215-307,338-387
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000129
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005171
Domain Number - Region: 109-187
Classification Level Classification E-value
Superfamily USP8 N-terminal domain-like 0.0157
Family USP8 N-terminal domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005171   Gene: ENSNLEG00000004263   Transcript: ENSNLET00000005434
Sequence length 1034
Comment pep:known_by_projection supercontig:Nleu1.0:GL397308.1:17162263:17189538:1 gene:ENSNLEG00000004263 transcript:ENSNLET00000005434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPAVICQEDSIEEEWVGL
LEYLSRISICKQKKDYCKKYRKYVRSRFQCIEDRNARLGERVSLNKRYTRLRLIKEHRSQ
QEREQELLAIGKTKTCESPVSPIKMELLFDPDDEHSEPVHTVVFQGAAGIGKTILARKIM
LDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCCPDPNPPIHKIVRKPSRILFL
MDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITTRPVALEKLQH
LLDHPRHVEILGFSEAKRKEYFFKYFSDEAQARAAFSLIQENEVLFTMCFIPLVCWIVCT
GLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHRLCAHLWGLCSLAADGIWNQ
KILFEESDLRNHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEK
EGRTNLPGSRLKLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKI
SQQIRLELLKWIEVKAKAKKLQIQPSQLELFYCLYEMQEEDFVQRAMDYFPKIEINLSTR
MDHVVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKXXXXXXXXXXXXFLSVFLLIPRLV
NSHLTSSFCRGLFSVLSTSQSLTELDLSDNSLGDPGMTVLCETLQHPGCNIQRLWLGRCG
LSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLFCNLKKLWLVSCCLTS
ACVRILISLSTNHSLTRLYMGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCS
ALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLS
TLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQ
EEKPELTVVFEPSW
Download sequence
Identical sequences ENSNLEP00000005171 ENSNLEP00000005171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]