SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005175 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005175
Domain Number 1 Region: 41-145
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000897
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 2 Region: 114-221
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000481
Family C1 set domains (antibody constant domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005175   Gene: ENSNLEG00000004251   Transcript: ENSNLET00000005439
Sequence length 269
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:18723791:18756764:1 gene:ENSNLEG00000004251 transcript:ENSNLET00000005439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLVIRMPFCHLSTYSLVWGMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEAL
IVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYM
CLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIE
NSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLL
LSIVSLVILLVLISILLYWKRHRNQDREP
Download sequence
Identical sequences A0A2I3FWF0
XP_003261856.1.23891 ENSNLEP00000005175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]