SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005196 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005196
Domain Number 1 Region: 423-494
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000174
Family DEATH domain, DD 0.0082
Further Details:      
 
Domain Number 2 Region: 106-165
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000181
Family TNF receptor-like 0.017
Further Details:      
 
Domain Number 3 Region: 64-107
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000316
Family TNF receptor-like 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005196
Domain Number - Region: 593-649
Classification Level Classification E-value
Superfamily DEATH domain 0.0181
Family Caspase recruitment domain, CARD 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005196   Gene: ENSNLEG00000004300   Transcript: ENSNLET00000005466
Sequence length 654
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:10649948:10728080:1 gene:ENSNLEG00000004300 transcript:ENSNLET00000005466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSASSSTALASCSLIVRRARATMIAVSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRA
TGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEK
LPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVP
SSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFSSSTSPSPGTAIFSRPEHVESHE
VPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNH
QQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNIHKHFDINEHLPWMIVLFLLL
VLVVIVVCSVRKSSRTLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGHGIDIYN
IEAFVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLISA
LRQHRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNAKLENSALLTVEPS
PQDKNKGFFVDESEPLLRCDSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIFD
DMLHFLNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL
Download sequence
Identical sequences G1QW75
ENSNLEP00000005196 ENSNLEP00000005196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]