SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005210 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005210
Domain Number 1 Region: 110-233
Classification Level Classification E-value
Superfamily Fibronectin type III 7.99e-49
Family Fibronectin type III 0.00000025
Further Details:      
 
Domain Number 2 Region: 234-325
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000503
Family Fibronectin type III 0.00000223
Further Details:      
 
Domain Number 3 Region: 31-107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000163
Family I set domains 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005210   Gene: ENSNLEG00000004287   Transcript: ENSNLET00000005482
Sequence length 328
Comment pep:known_by_projection supercontig:Nleu1.0:GL397318.1:3681810:3696581:-1 gene:ENSNLEG00000004287 transcript:ENSNLET00000005482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDKSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGKVLSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDLQGVTCGAATLSAERI
RGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFMDKTSATVIC
RKNASFSVRAQDRYYSSSWSEWASVPCN
Download sequence
Identical sequences G1QW89
ENSNLEP00000005210 ENSNLEP00000024339 ENSNLEP00000005210 XP_003268647.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]