SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005258 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005258
Domain Number 1 Region: 119-482
Classification Level Classification E-value
Superfamily L domain-like 2.04e-57
Family Internalin LRR domain 0.07
Further Details:      
 
Domain Number 2 Region: 688-783
Classification Level Classification E-value
Superfamily Immunoglobulin 2.97e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 601-697
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-20
Family I set domains 0.009
Further Details:      
 
Domain Number 4 Region: 496-605
Classification Level Classification E-value
Superfamily Immunoglobulin 4.68e-17
Family I set domains 0.019
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005258
Domain Number - Region: 46-114
Classification Level Classification E-value
Superfamily L domain-like 0.00184
Family Ngr ectodomain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005258   Gene: ENSNLEG00000004313   Transcript: ENSNLET00000005533
Sequence length 1064
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:8416876:8473545:1 gene:ENSNLEG00000004313 transcript:ENSNLET00000005533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAPLGVPEEQLLGCRSGLLSRLLFIAQTALLLLPAAGAGLCPAPCSCRIPLLDCSRRK
LPAPSWRALSGLLPPDTAILDLSHNRLSDWNISLELQTLQEVKMNYNELTEIPYFGEPTS
NITLLSLVHNIIPEINAQALQFYPALESLDLSSNIISEIKTSSFPRMQLKYLNLSNNRIT
TLEAGCFDNLSSSLLVVKLNRNRISMIPPKIFKLPHLQFLELKRNRIKIVEGLTFQGLDS
LRSLKMQRNGISKLKDGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQLYVSQNAIE
RISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFLSN
LQTLDLRNNEISWAIEDASEAFAGLEVSLNILQGNQIKSITKKAFIGLESLEHLDLNNNA
IMSIQENAFSQTHLKELILNTSSLLCDCHLKWLLQWLVDNNFQHSVNVSCAHPEWLAGQS
ILNVDLKDFVCDDFLKPQIRTHPETIIALRGMNVTLTCTAVSSSDSPMSTVWRKDSEVLY
DVDIENFVRYRQQAGEALEYTSILHLFNVNFTEEGKYQCIVTNHFGSNYSQKAKLTVNEM
PSFLKTPMDLTIRTGAMARLECAAEGHPAPQISWQKDGGTDFPAARERRMHVMPEDDVFF
IANVKIEDMGIYSCMAQNTAGGLSANASLTVLETPSFIRPLEDKTVTRGETAVLQCIAGG
SPAPRLNWTKDDGPLLVTERHFFAAANQLLIIVDAGLEDAGKYTCIMSNTLGTERGHIYL
NVISSPNCDSSQSSIGHEDDGWTTVGIVIIVVVCCVVGTSLIWVIVIYHMRRKNEDYSIT
NTEELNLPADIPSYLSSQGTLSEPQEGYSNSEAGSHQQLMPPANGYIHKGTDGGTGTRVI
CSDCYDNANIYSRTREYCPYTYIAEEDVLDQTLSSLMVQMPKETYLAHPAQDTTALESLI
SSANREPSAFPTNHERISEKKLPSTQMSGEALQWPVWNINRELGLPHPPFSQQPVHESPQ
LHQNEGLAGREPDCSASSMSCHRLQDHAFDFSRTRNIQDGSEGT
Download sequence
Identical sequences ENSNLEP00000005258 ENSNLEP00000005258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]