SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005271 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005271
Domain Number 1 Region: 778-1059
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.91e-70
Family Protein kinases, catalytic subunit 0.00000101
Further Details:      
 
Domain Number 2 Region: 594-687
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 412-501
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-20
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 126-219
Classification Level Classification E-value
Superfamily Immunoglobulin 4.46e-18
Family I set domains 0.026
Further Details:      
 
Domain Number 5 Region: 502-589
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000178
Family I set domains 0.02
Further Details:      
 
Domain Number 6 Region: 329-418
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000034
Family I set domains 0.018
Further Details:      
 
Domain Number 7 Region: 227-317
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000138
Family I set domains 0.05
Further Details:      
 
Domain Number 8 Region: 31-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000217
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005271   Gene: ENSNLEG00000004223   Transcript: ENSNLET00000005546
Sequence length 1070
Comment pep:known_by_projection supercontig:Nleu1.0:GL397304.1:16651762:16737708:-1 gene:ENSNLEG00000004223 transcript:ENSNLET00000005546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAARGSPARPRRLPLLSVLLLPLLGGTQAAIIFIKQPSSQDALQGRRALLRCEVEAPGP
VHVYWLLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFN
IKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSS
KERNLTLRPAGPEHSGLYSCCAHNAFGQACSSQNFTLSIADESFARVVLAPQDVVVARNE
EAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRNAGVYR
CIGQGQRGPPVILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAG
VRLPTHGRVYQKGHELVLASIAESDAGVYTCHAANLAGQRRQDVNITVATVPTWLKKPQD
SQLEEGKPGYLHCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINNVEVYDGTWYR
CVSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIKWERAD
GSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER
TTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSG
RYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVL
GLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATN
KRHSTSDKVHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQ
LDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVELGDLKQFLRISKSKDEKLKSQ
PLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEY
YHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQ
DGKARLPQPEGCPSKLYRLMQHCWAPSPKDRPSFSEIASALGDSPVDSKP
Download sequence
Identical sequences A0A2I3HRK6
XP_003266288.1.23891 ENSNLEP00000005271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]