SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005281 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005281
Domain Number 1 Region: 170-256
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.89e-26
Family Thyroglobulin type-1 domain 0.0000038
Further Details:      
 
Domain Number 2 Region: 28-110
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.49e-19
Family Growth factor receptor domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005281   Gene: ENSNLEG00000004201   Transcript: ENSNLET00000005556
Sequence length 259
Comment pep:known_by_projection supercontig:Nleu1.0:GL397320.1:10477415:10482696:1 gene:ENSNLEG00000004201 transcript:ENSNLET00000005556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEVPAARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVPASCSEVTRSAGCGCC
PMCALPLGAACGVATARCARGLSCRALPGEQQPLQALTRGQGACVRESDASASHAAEAGS
PESPESTEITEEELLDNFHLMAPSEENHSILWDAINTYDGSKALHVTNIKKWKEPCRIEL
YRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP
GSPEIRGDPNCQTYFNVQN
Download sequence
Identical sequences ENSNLEP00000005281 XP_003268956.1.23891 ENSNLEP00000005281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]