SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005326 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005326
Domain Number 1 Region: 91-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000051
Family I set domains 0.056
Further Details:      
 
Domain Number 2 Region: 138-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000841
Family I set domains 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005326   Gene: ENSNLEG00000004397   Transcript: ENSNLET00000005602
Sequence length 265
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:19198263:19223716:-1 gene:ENSNLEG00000004397 transcript:ENSNLET00000005602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASRLLISIIIMVSASSSSCMDGKQMTQNYSTISAEGNISQPVLMDTNAVLCCPPIALR
NLIIITEIILRGQPSCTKAYKKETNETKETNCTDRITWVSRPDQNSDLQIRPVAITHDGY
YRCLMVTPHGNFHRGYHLQVLVTPEVTVFQSRNRIAVCKAVAGKPAAQISWIPEGSILAT
KQEYWSNGTVTVRSTCHWEGHMSTMTCHVSHLTGNKSLSIKLNSGLRTSGSPALSLLIIL
YVKSLFVVILVTTGFVFFQRINHVR
Download sequence
Identical sequences ENSNLEP00000005326 ENSNLEP00000005326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]