SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005333 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005333
Domain Number 1 Region: 51-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000357
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 
Domain Number 2 Region: 151-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000822
Family C1 set domains (antibody constant domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005333   Gene: ENSNLEG00000004401   Transcript: ENSNLET00000005609
Sequence length 325
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:19290690:19367471:-1 gene:ENSNLEG00000004401 transcript:ENSNLET00000005609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCPWRTANLGLLLILTVFLVAASNSLCMDEKQITQNYSKVLAEVNTSWPVQMATNAVLC
CPPIAFGDLIIITWEIILRGQPSCTKAYRKETNETKETNCTDERITWVSRPDQNSDLQIR
PVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAQISW
IPEGDCATKQEHWSNGTVTVKSTCHWEVHNVSTVTCHVSHLTGNKSLYVELLPVPGAKKS
AKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTESTPVAEEDEMQPYASYTEKNNP
LYDTTNKVKASQALQSEVGTDLHTL
Download sequence
Identical sequences G1QWL2
XP_003261864.1.23891 ENSNLEP00000005333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]