SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005337 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005337
Domain Number 1 Region: 280-367
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000419
Family I set domains 0.03
Further Details:      
 
Domain Number 2 Region: 473-552
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000114
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 
Domain Number 3 Region: 170-262
Classification Level Classification E-value
Superfamily SEA domain 0.000000275
Family SEA domain 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005337
Domain Number - Region: 975-1295
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000265
Family Rhodopsin-like 0.036
Further Details:      
 
Domain Number - Region: 383-466
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0208
Family I set domains 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005337   Gene: ENSNLEG00000004314   Transcript: ENSNLET00000005615
Sequence length 1346
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:11043254:11114945:1 gene:ENSNLEG00000004314 transcript:ENSNLET00000005615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPRRTTLCLMFVVIYSSKAALNWNFESTIHPLSLHEREPAGEEALRQKRAVATKSPTA
EEYTVNIEINFENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWC
SCETGYGWPRERCLHNLTCQEHDVFLPGHHCSCLKELPPKGPFCLLQEDVTLNMRVRLNV
GFQEDLMNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKTTPPS
LELIHKANEQVVQSLNQTYKMDYNSFQAVASNESNFSVTPEIILEGDTVSLVCEKEVLSS
NVSWRYEEQQLEIQNSSRFSIYTAVFNNMTSVSKLTIHNITPGDAGEYVCKLILDIFEYE
CKKKIDVMPIQILANEEMKVMCDNNPVSLNCCSQSNVNWSKVEWKQEGKISIPGTAETDI
DSSCSRYTLKADGTQCPSGSSGTTVVYTCEFISAYGARGSANTKVTFISVANLTITPDPI
SVSEGQNFSIKCISDVSNYDEVYWNTSAGIKIYQRFYTTRRYPDGAESVLTVKTSTWEWN
GTYHCIFRYKNSYSIATKDVIVHPLPLKLNIMVDPLEATVSCSGSHHIKCCIEEDGDYKV
TFHMDSLSLPAAKEVNEKQTCYKHNFNANSVSWCSKTVDVYCHFTNAANNSVWSPSMKLN
LVPGENITCQDPVIGVGEPGKVIQKLCRFSNVPSSPDGPLGGIITYKCVGSQWEEKRNDC
ISAPINSLLQMAKALIKSPSQDEMLPTYLKDLSISIDKVEHEISSSPGSLGAIISILDLL
STVPTQVNSEMMMHVLSTVNVILGKPVLNTWKVLQQQWTNQSSQLLHSVERFSQALQSGD
SPPLSFSRTNVQMSSMVIKASHPKTYQQRFVFPYFDLWGDVVIDKSYLENLQSDSSIVTM
AFPTLQAILAQDIQENNFAESLVMTTIVSHNMTMPFRISMTFKNNSPSGGETKCVFWNFR
LANNTGGWDSSGCYVEEGDGDNVTCICDHLTSFSILMSPDSPDPSSLLGILLDIISYVGV
GFSILSLAACLVVEAVVWKSVTKNRTSYMRHTCIVNIAASLLVANTWFIVVAAIQDNRYI
LCKTACVAATFFIHFFYLSVFFWMLTLGLMLFYRLVFILHETSRSTQKAIAFCLGYGCPL
AISVITLGATQPREVYTRKNVCWLNWEDTKALLAFAIPALIIVVVNITITIVVITKILRP
SIGDKPCKQEKSSLFQISKSIGVLTPLLGLTWGFGLTTVFPGTNLVFHIIFAILNVFQGL
FILLFGCLWDLKVQEALLNKFSLSRWSSQHSKSTSLGSSTPVFSMSSPISRRFNNLFGKT
GTYNVSTPEATSSSLENSSSASSLLN
Download sequence
Identical sequences G1QWL6
XP_003254249.1.23891 XP_003254250.1.23891 XP_003254251.1.23891 ENSNLEP00000005337 ENSNLEP00000005337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]