SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005358 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005358
Domain Number 1 Region: 481-517
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000901
Family Ovomucoid domain III-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005358   Gene: ENSNLEG00000004414   Transcript: ENSNLET00000005636
Sequence length 551
Comment pep:known_by_projection supercontig:Nleu1.0:GL397358.1:6585953:6595494:-1 gene:ENSNLEG00000004414 transcript:ENSNLET00000005636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKPAAGFLPSLLKVLLLPLAPAPAQDSTQASTQVSPLSPTEYERFFALLTPTWKAETTC
RLRATHGCRNPTLVQLDQYENHGLVPDGAVCSNLPYASWFESFCQFTQYRCSNHIYYAKR
VLCSQPVSILSPNTLKEIEAPAEVSPTTMTSPISPHFTVTKQRQAFQPWPERLSNNVEEL
LQSSLSLGGQEQAPEHKLKQGVEHRQEQGVEHPQEPMQEHKQEEGQKQEEQEEEQEEEGK
QEEGQGTKEGLEAVSQLQTDSEPKFHSESLSSNPSSFTPRVREVESAPMMMESVQELIRS
AQEMDEMNEIYDENSHWRNQNPGSLLQLPHTEALLVLCYSIVENTCIITPTAKAWKYMEE
EILGFGKSVCDSLGRRHMSTCALCDFCSLKQEQCHSEVSVERQQCDAYHKTPVSPLLASQ
SLSFGNQVGSPESGRFYGLDLYGGLRMDFWCARLATKGCEDIRVSGWLRTEFLSFQDGDF
PTKICDTDYIQYPNYCSFKSQQCLMRNRNRKVSRMRCLQNETYSALSPGKSEDVVLRWSQ
EFSTLTLGQFG
Download sequence
Identical sequences ENSNLEP00000005358 ENSNLEP00000005358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]