SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005376 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005376
Domain Number 1 Region: 218-354
Classification Level Classification E-value
Superfamily C-type lectin-like 1.06e-19
Family C-type lectin domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005376   Gene: ENSNLEG00000004400   Transcript: ENSNLET00000005655
Sequence length 365
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:22333696:22347967:1 gene:ENSNLEG00000004400 transcript:ENSNLET00000005655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAITYADLRFVKAPLKKSISSRLGQDPGADEDGELTYENVQVPTVRGGPSSLASSVLG
DKAAVKSEQPTESWRAVTSPAVGRILPCRTACLRYLLLGLLLTCLLLGVAAICLGVRYLQ
VSQQLQQMNRVLEATNSSLRQQLHLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQA
AEGQLQACQADREKTKETLQSEEQQRRALEQKLSNMENTLKPFFPCRSADTCCPMGWIMH
QKSCFYISPTSKNWQESQKHCETLSSKLATFSETYQQSHSYSTLNWLLPNRDSEDSYWNG
LSSNKDGKLTDDTQHTRTYAQSSRCTKVHKIWTWWKLESEACRSYLPYICEMTAFRFPHL
DSPLH
Download sequence
Identical sequences A0A2I3HNN6
ENSNLEP00000005376 ENSNLEP00000005376 XP_003263414.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]