SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005418 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005418
Domain Number 1 Region: 606-810
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-33
Family Fibronectin type III 0.00000283
Further Details:      
 
Domain Number 2 Region: 316-407
Classification Level Classification E-value
Superfamily Immunoglobulin 2.61e-22
Family I set domains 0.0061
Further Details:      
 
Domain Number 3 Region: 237-326
Classification Level Classification E-value
Superfamily Immunoglobulin 9.12e-18
Family I set domains 0.023
Further Details:      
 
Domain Number 4 Region: 36-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000166
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 468-574
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000401
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 6 Region: 136-211
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000026
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005418   Gene: ENSNLEG00000004455   Transcript: ENSNLET00000005701
Sequence length 1116
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:19581707:19653052:1 gene:ENSNLEG00000004455 transcript:ENSNLET00000005701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGTMMAWRGTRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVE
PPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPA
TVTLANLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRGNYLIM
PSGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRRSTAEAARIIYPPEAQTI
IVTKGQSLILECVASGIPPPRVTWAKDGSSVAGYNKTRFLLSNLLIDTTSEEDSGTYRCM
ADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNA
VPLISSQRLRLSRRALRVLSMGPEDEGVYQCMAENEVGSAHAVVQLRTSRPSITPRLWQD
AELATGTPPVPPSKPGNPEQMLRGQPALPRPPTSGRPAPPQCPGEKGQGAPAEAPIILSS
PRTSKTDSYELVWRPRHEGSGRAPILYYVVKHRKQVTNSSDDWTISGIPANQHRLTLTRL
DPGSLYEVEMAAYNCAGEGQTAMVTFRTGRRPKPEIMASKEQQIQRDDPGASPQSSSQPD
HGRLSPPEAPDRPTISMASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAI
PPSRLSVEITGLEKGTSYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYIT
FTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDRYWHSISH
LQPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQPGRVPPPTLAPPQPPPPETIER
PVGTGTMVARSSDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALPP
SSCPYTMVPLGGLPGHQASGQPYLSGISGRACANGVHMNRGCPAAAVGYQGMKPQQHCPG
ELQQQNDTSSLLRQTHLGNGYDPQSHQITRGPKSSPDEGSFLYTLPDDSTHQLLQPHHDC
CQRQEQPAAVGQSGVRRAPDSPVLEAIWDPPFHSGPPCCLGLVPVEEVDSSDSCQVSGGD
WCPQHPIGAYVGQEPGMQLSLGPPVHVSFETPPPTI
Download sequence
Identical sequences ENSNLEP00000005418 ENSNLEP00000005418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]