SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005445 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005445
Domain Number 1 Region: 294-505
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-23
Family Laminin G-like module 0.093
Further Details:      
 
Domain Number 2 Region: 112-231
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000123
Family Cadherin 0.0069
Further Details:      
 
Domain Number 3 Region: 1-116
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000657
Family Cadherin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005445   Gene: ENSNLEG00000004476   Transcript: ENSNLET00000005729
Sequence length 920
Comment pep:known_by_projection supercontig:Nleu1.0:GL397300.1:16450371:16849646:1 gene:ENSNLEG00000004476 transcript:ENSNLET00000005729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNKHKPWIETSYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHGQELPFEAVV
LNKTSGEGRLRAKSPIDCELQKEYTFIIQAYDCGAGPHETAWKKSHKAVVHIQVKDVNEF
APTFKEPAYKAVVTEGKIYDSILQVEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIR
NTEKLSYDKQHQYEILVTAYDCGQKPAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGS
MPLFPSIHLETCDGAVSSLQIVAELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPS
PSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKNLTDQFTITMWMKHGPSPGVRAE
KETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHY
YVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSHIAMQLTVGACWQGGEVTKPRFAQFFH
GSLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGQGIKYHFNPSQSILVMEGDDIG
NINRALQKISYINSRQFPTAGVRRLKVSSKVQCFGEDVCISIPEVDAYVMVLQAIEPRIT
LRGTDHFWRPAAQFESARGVTLFPDIKIVSTFAKTEAPGDVKTTAPKSEVLEEMLHNLDF
CDILVIGGDLDPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMSRYEQVLHHIRYRN
WRPASLEARHFRIKCSELNGRYTSNEFNLEVSVLHEDRVSDKEHVNHLIVQPPFLQSVHH
PESRSSIQHSSVVPSIATVVIIISVCMLVFVVAMGVYRVRIAHQHFIQETEAAKESEMDW
DDSALTITVNPMEKHEGPGHGEDETEGEEEEEAEEEMSSSSGSDDSEEEEEEEEGMGRGR
HGQNGARQAQLEWDDSTLPY
Download sequence
Identical sequences ENSNLEP00000005445 ENSNLEP00000005445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]