SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005461 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005461
Domain Number 1 Region: 603-701
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000124
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 284-342
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000992
Family B-box zinc-binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 143-219
Classification Level Classification E-value
Superfamily RING/U-box 0.000000471
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005461   Gene: ENSNLEG00000004507   Transcript: ENSNLET00000005745
Sequence length 723
Comment pep:known_by_projection supercontig:Nleu1.0:GL397300.1:16950213:16973350:1 gene:ENSNLEG00000004507 transcript:ENSNLET00000005745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METAMCVCCPCCTWQRCCPQLCSCLCCKFIFTSERNCTCFPCPYKDERNCQFCHCTCSES
PNCHWCCCSWANDPNCKCCCTASSNLKCYYYESHCCRNTIITFHKGRLRRIHTSSKTALR
IGSSDTQVDEVKSIPANSHLVNHLNCPMCSRLRLHSFMLPCNHSLCEKCLRQLQKHAEVT
ENFFILICPVCDRSHCMPYSNKMQLPENYLHRRLTKRYMQEHGYLKWRFDRSSGPILCQV
CRNRRIAYKRCVTCRLNLCNDCLKAFHSDVAMQDHVFVDTSAEEQDEKICIHHPSSRIIE
YCRNDNELLCTFCKFSFHNGHDTISLIDACSERAASLFSAIAKFKAVRYEIDNDLMEFNI
LKNSFKADKEAKRKEIRNGFLKLRSILQEKEKIIMEQIENLEVSRQKEIEKYVYVTTMKV
NEMDGLIAYAKEALKETGQVAFLQSAKILVDQIEDGIQTTYRPDPQLRLHSINYMPLDFV
ELSSAIHELFPTGPKKVRSSGDSLPSPYPMHSETMIARKVTFSTHSLGNQQIYQRSSSVL
SFSNTDEKAKVGLEACGRAQSATPAKPTDGLYTYWSVGADSQSVQNSSSFHNWYSFNDGS
VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQMELCGQIQDIM
QQNLELHNLTPNTEYVFKVRAINDNGPGQWSDICKVVTPDGHGKNRAKWGLLKNIQSALQ
RHF
Download sequence
Identical sequences G1QWZ0
ENSNLEP00000005461 XP_003265359.1.23891 ENSNLEP00000005461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]