SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005544 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005544
Domain Number 1 Region: 721-895
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-41
Family MAM domain 0.00031
Further Details:      
 
Domain Number 2 Region: 417-517
Classification Level Classification E-value
Superfamily Immunoglobulin 4.06e-17
Family I set domains 0.036
Further Details:      
 
Domain Number 3 Region: 217-304
Classification Level Classification E-value
Superfamily Immunoglobulin 5.7e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 24-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000154
Family I set domains 0.04
Further Details:      
 
Domain Number 5 Region: 322-403
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000181
Family I set domains 0.019
Further Details:      
 
Domain Number 6 Region: 128-195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000855
Family I set domains 0.035
Further Details:      
 
Domain Number 7 Region: 512-603
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000107
Family I set domains 0.034
Further Details:      
 
Domain Number 8 Region: 567-704
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000173
Family Fibronectin type III 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005544   Gene: ENSNLEG00000004527   Transcript: ENSNLET00000005830
Sequence length 932
Comment pep:known_by_projection supercontig:Nleu1.0:GL397292.1:22151978:22617981:-1 gene:ENSNLEG00000004527 transcript:ENSNLET00000005830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPTVRIVHSGLACNIEEERYSERVYTIREGETLELTCLVTGHPRPQIRWTKTAGSASDR
FQDSSVFNETLRITNIQRHQGGRYYCKAENGLGSPAIKSIRVDVYYLDDPVVTVHQSIGE
AKEQFYYERTVFLRCVANSNPPVRYSWRRGQEVLLQGSDKGVEIYEPFFTQGETKILKLK
NLRPQDYANYSCIASVRNVCNIPDKMVSFRLSNKTASPSIKLLVDDPIVVNPGEAITLVC
VTTGGEPAPSLTWVRSFGTLPEKTVLNGGTLTIPAITSDDAGTYSCIANNNVGNPAKKST
NIIVRALKKGRFWITPDPYHKDDNIQIGREVKISCQVEAIPSEELTFGWFKNGRPLRSSE
RMVITQTDPDVSPGTTNLDIIDLKFTDFGTYTCVASLKGGGISDISIDVNISSSTVPPNL
TVPQEKSPLVTREGDTIELQCQVTGKPKPIILWSRADKEVAMPDGSMQMESYDGTLRIVN
VSREMSGMYRCQTSQYNGFNVKPREALVQLIVQYPPAVEPAFLEIRQGQDRSVTMSCRVL
RAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYPVKSLSNENYGVYNCSIINEAGAGRCSF
LVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQMNPDAVDRIVAYRLGIRQAGQQRWW
EQEIKINGNIQKGELITYNLTELIKPEAYEVRLTPLTKFGEGDSTIRVIKYSAPVNPHLR
EFHCGFEDGNICLFTQDDTDNFDWTKQSTATRNTKYTPNTGPNADRSGSKEGFYMYIETS
RPRLEGEKARLLSPVFSIAPKNPYGPTNTAYCFSFFYHMYGQHIGVLNVYLRLKGQTTIE
NPLWSSSGNKGQRWNEAHVNIYPITSFQLIFEGIRGPGIEGDIAIDDVSIAEGECAKQDL
ATKNSVDGAVGILVHIWLFPIIVLISILSPRR
Download sequence
Identical sequences ENSNLEP00000005544 ENSNLEP00000005544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]