SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005568 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005568
Domain Number 1 Region: 343-471
Classification Level Classification E-value
Superfamily TIMP-like 1.08e-27
Family Tissue inhibitor of metalloproteinases, TIMP 0.036
Further Details:      
 
Domain Number 2 Region: 210-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000028
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 3 Region: 155-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family EGF-type module 0.07
Further Details:      
 
Domain Number 4 Region: 273-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005568   Gene: ENSNLEG00000004598   Transcript: ENSNLET00000005856
Sequence length 487
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:622286:631966:-1 gene:ENSNLEG00000004598 transcript:ENSNLET00000005856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTFALLLLLGQATADPCYDPQGRPQFCLPPVTQLAAVAASCPQACVLSPGKHLGPRET
CNGSLTALGGPFLLTSTGPGGLPRPGTPTLAYVSPAKTHSPCLCLPATGMFPSLPGTGVT
FHSTPGPKATVAASHLRVEFGGQAGLAAAGLRGRCQCHGHAARCAARARPPRCHCRHHTT
GPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERC
RHHTAGRHCHYCQPGFWRDPSQPISSRRACRACQCHPIGATGGTCNQTSGQCTCKLGVTG
LTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDTRVHMSLRR
YCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYKQRAQPLRRGDQDAWVPRADLACGCLS
LQPGTDYLLLSSAVSDPDPTRLILDRHGLALPWRPRWARPLRRLQEEERAGGCRGLRAPT
PSPRPDH
Download sequence
Identical sequences ENSNLEP00000005568 ENSNLEP00000005568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]