SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005572 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005572
Domain Number 1 Region: 214-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000628
Family VWC domain 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005572
Domain Number - Region: 153-213
Classification Level Classification E-value
Superfamily FnI-like domain 0.00045
Family Fibronectin type I module 0.04
Further Details:      
 
Domain Number - Region: 278-323
Classification Level Classification E-value
Superfamily FnI-like domain 0.0534
Family Fibronectin type I module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005572   Gene: ENSNLEG00000004599   Transcript: ENSNLET00000005860
Sequence length 325
Comment pep:known_by_projection supercontig:Nleu1.0:GL397320.1:14403135:14541079:1 gene:ENSNLEG00000004599 transcript:ENSNLET00000005860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSTAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVN
ELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQDGGAKAGDLQVRPRGDTPQG
EALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLC
TEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCR
CEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTIC
HCTYEEGTWRIERQAMCTRHECRQM
Download sequence
Identical sequences G1QXA1
ENSNLEP00000005572 XP_003268971.1.23891 ENSNLEP00000005572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]