SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005586 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005586
Domain Number 1 Region: 91-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.41e-19
Family B-box zinc-binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 1.17e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 308-353
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000158
Family SPRY domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005586   Gene: ENSNLEG00000004590   Transcript: ENSNLET00000005874
Sequence length 354
Comment pep:known_by_projection supercontig:Nleu1.0:GL397342.1:6175888:6200883:-1 gene:ENSNLEG00000004590 transcript:ENSNLET00000005874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERL
Download sequence
Identical sequences ENSNLEP00000005586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]