SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005596 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005596
Domain Number 1 Region: 93-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000013
Family I set domains 0.052
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005596
Domain Number - Region: 298-339
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0683
Family TNF receptor-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005596   Gene: ENSNLEG00000004604   Transcript: ENSNLET00000005884
Sequence length 351
Comment pep:known_by_projection supercontig:Nleu1.0:GL397320.1:14566294:14723467:-1 gene:ENSNLEG00000004604 transcript:ENSNLET00000005884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASALGPARQGRRRTRVAGSLLSRAAILLFISAFLVRVPSSVGHLVRLPRAFRLTKDSV
KIVGSTSFPVKVYVMLHQKSPHVLCVTQQLRNAELIDPSFQWYGPKGKVVSVENRTAQIT
STGSLVFQNFEESMSGIYTCFLEYKPTVEETVKHLQLKYAIYAYREPHYYYQFTARYHAA
PCNSIYNISFEKKLLQILSKLLLDLSCEISLLKSECHHVKMQRAGLQNELFFTFSVSSLD
TEKGPKPCTDHNCEPSKRLFKAKNLIERFFNQQVEILGRRAEQLPQIYYIEGTLQMVWIN
RCFPGYGMNVQQHPKCPECCVICSPGSYNPRDGIHCLQCNSSLVYGAKTCL
Download sequence
Identical sequences G1QXC5
XP_003268972.1.23891 ENSNLEP00000005596 ENSNLEP00000005596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]