SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005605 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005605
Domain Number 1 Region: 131-454
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.63e-66
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000196
Further Details:      
 
Domain Number 2 Region: 477-607
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.05e-30
Family Ricin B-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005605   Gene: ENSNLEG00000004613   Transcript: ENSNLET00000005894
Sequence length 608
Comment pep:known_by_projection supercontig:Nleu1.0:GL397332.1:11529594:11607187:1 gene:ENSNLEG00000004613 transcript:ENSNLET00000005894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVTVRYFCYGCLFTSATWTVLLFVYFNFSEVTQPLKNVPVKGSGPHGPSPKKFYPRFT
RGPSRVLEPQFKANKIDDVIDSHVEDPEKGHLKFSSELGMIFNERDQELRDLGYQKHAFN
MLISNRLGYHRDVPDTRNAACQEKFYPPDLPSASVVICFYNEAFSALLRTAHSVIDRTPA
HLLHEIILVDDDSDFDDLKGELDEYVQKYLPGKIKVIRNTKREGLIRGRMIGAAHATGEV
LVFLDSHCEVNVMWLQPLLAAIREDQHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHF
KWDLVPLSELGGAEGATAPIKSPTMAGGLFAMNRQYFHELGQYDSGMDIWGGENLEISFR
IWMCGGKLFIIPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPD
LKTKSYGNISERVELRKKLGCKSFKWYLDNVYPEMQISGSHAKPQQPIFVNRGPKRPKVL
QRGRLYHLQTNKCLVAQGRPSQKGGLVVLKACDYSDPNQIWIYNEEHELVLNSLLCLDMS
ETRSSDPPRLMKCHGSGGSQQWTFGKNNRLYQVSVGQCLRAVDPLGQKGSVAMAICDGSS
SQQWHLEG
Download sequence
Identical sequences G1QXD4
ENSNLEP00000005605 XP_012367498.1.23891 XP_012367499.1.23891 ENSNLEP00000005605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]