SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005623 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005623
Domain Number 1 Region: 31-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000475
Family C1 set domains (antibody constant domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005623   Gene: ENSNLEG00000004632   Transcript: ENSNLET00000005915
Sequence length 281
Comment pep:known_by_projection supercontig:Nleu1.0:GL397304.1:16891695:16903387:-1 gene:ENSNLEG00000004632 transcript:ENSNLET00000005915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRTWLLLLLALGCPALLTGVGGTLFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGFDNP
IWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTRPGAEGHSRST
QPLQLSGEASTARTCPREPLSGTPSGALWLGVLRLLLFKLLLFDLLLTCSCLRDPAGPPP
SPTATTRLRALGSHRLHLATENGRREATSSPRPQPWDRRWGDTPPGRKPGSPVWEEGSYL
SSYHTYPARGWCSRSALRTPSSSLGAFFAGDLPPPLQAGAA
Download sequence
Identical sequences A0A2I3G3P5
ENSNLEP00000005623 XP_003266305.1.23891 ENSNLEP00000005623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]