SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000005628 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000005628
Domain Number 1 Region: 169-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000905
Family I set domains 0.047
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000005628
Domain Number - Region: 114-173
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0262
Family AN1-like Zinc finger 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000005628   Gene: ENSNLEG00000004623   Transcript: ENSNLET00000005920
Sequence length 350
Comment pep:known_by_projection supercontig:Nleu1.0:GL397326.1:703172:709301:-1 gene:ENSNLEG00000004623 transcript:ENSNLET00000005920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPHFTLLCAALAGCLLPAEGCVICDPSVMLALKSLEKDYLPGHLDVKHHKAMMERVENA
VKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVRGDLFVKELFWMLHLQKE
TFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMML
DCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNS
SPATIINFHVTVLPKRMKEEKPSPNIVTPGEATTESSITLQPLKPEKMLKSRLLGLLIFG
CLSLITGLTFAIVLRRKVIDFIKSSVFGLGSGAAEQTQVPKEKATDSRHQ
Download sequence
Identical sequences G1QXF7
ENSNLEP00000005628 ENSNLEP00000005628 XP_003269794.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]